A database of hormones and their receptors

Home

Hormone Peptide Non-peptide Search Search Browse Browse H-R Pair H-R Pair

Receptor Search Browse

Tools BLAST Domain Search Peptide Mapping Structure Search

Miscellaneous Online Submission HMRbase Information Supplementary Information Recent Information Help

Contact

Peptide Hormone

Search Result - 1

HMRbase accession number	10024
Swiss-prot Accession number	P63296 (Sequence in FASTA format)
Description	Secretin.
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates formation of NaHCO(3)-rich pancreatic juice and secretion of NaHCO(3)-rich bile and inhibits HCl production by the stomach
Protein Length	27 Amino acids
Molecular weight	3056
References	1  PubMed abstract 7250377
Domain Name	Hormone_2
Hormone Name	Secretin
Mature Hormone Sequence	HSDGTFTSELSRLRDSARLQRLLQGLV
Position of mature hormone in Pre-Hormone protein	27 Residues from position (1-27)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10238
Swiss-prot Accession number	P62326 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Seraspenide inhibits the entry of hematopoeitic pluripotent stem cells into the S-phase
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Yu J., Meng Y., Wang Z., Hansen C., Li C., Moore S.S.; "Analysis of sequences obtained from constructed full-length bovinecDNA libraries."; Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases. 2   Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 6940133 4  PubMed abstract 2915977 5  PubMed abstract 2253778 6  PubMed abstract 1551869 7  PubMed abstract 2261438 8  PubMed abstract 8269922
Domain Name	Thymosin
Hormone Name	Hematopoietic system regulatory peptide
Mature Hormone Sequence	SDKP
Position of mature hormone in Pre-Hormone protein	4 Residues from position (2-5)
Receptor	N/A
Gene ID	781334
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	10276
Swiss-prot Accession number	Q863C3 (Sequence in FASTA format)
Description	Gastrin-releasing peptide precursor (GRP) [Contains: Neuromedin-C(GRP-10) (GRP-(18-27))] (Fragment).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the bombesin/neuromedin-B/ranatensin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	126 Amino acids
Molecular weight	13840
References	1   Budipitojo T., Sasaki T., Cruzana M.B.C., Kitamura N., Yamada J.; "Molecular cloning of cDNA encoding an endometrial gastrin-releasingpeptide (GRP) of cow."; Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2755876
Domain Name	Bombesin
Hormone Name	Neuromedin-C
Mature Hormone Sequence	GNHWAVGHLM
Position of mature hormone in Pre-Hormone protein	10 Residues from position (41-50)
Receptor	N/A
Gene ID	615323
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	10303
Swiss-prot Accession number	P81264 (Sequence in FASTA format)
Description	Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	Medulla oblongata and hypothalamus
Post translational modification	N/A
Function	Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL
Protein Length	98 Amino acids
Molecular weight	10544
References	1  PubMed abstract 9607765
Domain Name	N/A
Hormone Name	Prolactin-releasing peptide PrRP31
Mature Hormone Sequence	SRAHQHSMEIRTPDINPAWYAGRGIRPVGRF
Position of mature hormone in Pre-Hormone protein	31 Residues from position (23-53)
Receptor	Q4EW11    Detail in HMRbase
Gene ID	286856
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 5

HMRbase accession number	10304
Swiss-prot Accession number	P81264 (Sequence in FASTA format)
Description	Prolactin-releasing peptide precursor (PrRP) (Prolactin-releasinghormone) [Contains: Prolactin-releasing peptide PrRP31; Prolactin-releasing peptide PrRP20].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	N/A
Tissue Specificity	Medulla oblongata and hypothalamus
Post translational modification	N/A
Function	Stimulates prolactin (PRL) release and regulates the expression of prolactin through its receptor GPR10. May stimulate lactotrophs directly to secrete PRL
Protein Length	98 Amino acids
Molecular weight	10544
References	1  PubMed abstract 9607765
Domain Name	N/A
Hormone Name	Prolactin-releasing peptide PrRP20
Mature Hormone Sequence	RTPDINPAWYAGRGIRPVGRF
Position of mature hormone in Pre-Hormone protein	21 Residues from position (33-53)
Receptor	Q4EW11    Detail in HMRbase
Gene ID	286856
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 6

HMRbase accession number	10344
Swiss-prot Accession number	Q95MI6 (Sequence in FASTA format)
Description	Corticoliberin precursor (Corticotropin-releasing factor) (CRF)(Corticotropin-releasing hormone).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the sauvagine/corticotropin-releasing factor/urotensin I family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This hormone from hypothalamus regulates the release of corticotropin from pituitary gland
Protein Length	190 Amino acids
Molecular weight	20739
References	1   Buchanan F.C., Thue T.D., Schmutz S.M.; "Sequence analysis of bovine corticotrophin-releasing hormone - acandidate gene for post-natal growth."; Submitted (JAN-2001) to the EMBL/GenBank/DDBJ databases.
Domain Name	CRF
Hormone Name	Corticoliberin
Mature Hormone Sequence	SQEPPISLDLTFHLLREVLEMTKADQLAQQAHXNRKLLDIA
Position of mature hormone in Pre-Hormone protein	41 Residues from position (148-188)
Receptor	Q9BGU4    Detail in HMRbase
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 7

HMRbase accession number	10347
Swiss-prot Accession number	Q9BDJ6 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-97 is essential for obestatin activity (By similarity).
Function	Ghrelin is the ligand for growth hormone secretagogue receptor type 1 (GHSR). Induces the release of growth hormone from the pituitary. Has an appetite-stimulating effect, induces adiposity and stimulates gastric acid secretion. Involved in growth regulation
Protein Length	116 Amino acids
Molecular weight	12793
References	1   Kita K., Harada K., Yokota H.; Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases. 2   Li C., Lobo S., Wang Z., Fu A., Meng Y., Murdoch B., Hansen C.,Moore S.; "A full length genomic sequence of the bovine ghrelin gene."; Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases. 3   Kojima M.; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Ghrelin
Mature Hormone Sequence	GSSFLSPEHQKLQRKEAKKPSGRLKPR
Position of mature hormone in Pre-Hormone protein	27 Residues from position (24-50)
Receptor	Q9BDH9   Detail in HMRbase    Q9N1F8   Detail in HMRbase    Q9TUJ0   Detail in HMRbase    Q9TUJ1    Detail in HMRbase
Gene ID	281192
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 8

HMRbase accession number	10348
Swiss-prot Accession number	Q9BDJ6 (Sequence in FASTA format)
Description	Appetite-regulating hormone precursor (Growth hormone secretagogue)(Growth hormone-releasing peptide) (Motilin-related peptide)[Contains: Ghrelin; Obestatin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein (By similarity)
Developmental Stage	N/A
Similarity	Belongs to the motilin family.
Tissue Specificity	N/A
Post translational modification	O-n-octanoylation is essential for ghrelin activity (By similarity). Amidation of Leu-97 is essential for obestatin activity (By similarity).
Function	Obestatin may be the ligand for GPR39. May have an appetite-reducing effect resulting in decreased food intake. May reduce gastric emptying activity and jejunal motility
Protein Length	116 Amino acids
Molecular weight	12793
References	1   Kita K., Harada K., Yokota H.; Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases. 2   Li C., Lobo S., Wang Z., Fu A., Meng Y., Murdoch B., Hansen C.,Moore S.; "A full length genomic sequence of the bovine ghrelin gene."; Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases. 3   Kojima M.; Submitted (DEC-1999) to the EMBL/GenBank/DDBJ databases.
Domain Name	Motilin_assoc  Motilin_ghrelin
Hormone Name	Obestatin
Mature Hormone Sequence	FNAPFNIGIKLAGAQSLQHGQTL
Position of mature hormone in Pre-Hormone protein	23 Residues from position (75-97)
Receptor	Q9BDH9   Detail in HMRbase    Q9N1F8   Detail in HMRbase    Q9TUJ0   Detail in HMRbase    Q9TUJ1    Detail in HMRbase
Gene ID	281192
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 9

HMRbase accession number	10408
Swiss-prot Accession number	P03972 (Sequence in FASTA format)
Description	Muellerian-inhibiting factor precursor (MIS) (Anti-Muellerian hormone)(AMH) (Muellerian-inhibiting substance).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the TGF-beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	This glycoprotein, produced by the Sertoli cells of the testis, causes regression of the Muellerian duct. It is also able to inhibit the growth of tumors derived from tissues of Muellerian duct origin
Protein Length	575 Amino acids
Molecular weight	60624
References	1  PubMed abstract 3754790
Domain Name	N/A
Hormone Name	Muellerian-inhibiting factor
Mature Hormone Sequence	REEVFSTSALPREQATGSGALIFQQAWDWPLSSLWLPGSPLDPLCLVTLHGSGNGSRAPLRVVGVLSSYEQAFLEAVRRTHWGLSDLTTFAVCPAGNGQPVLPHLQRLQAWLGEPGGRWLVVLHLEEVTWEPTPLLRFQEPPPGGASPPELALLVVYPGPGLEVTVTGAGLPGTQSLCLTADSDFLALVVDHPEGAWRRPGLALTLRRRGNGALLSTAQLQALLFGADSRCFTRKTPALLLLLPARSSAPMPAHGRLDLVPFPQPRASPEPEEAPPSADPFLETLTRLVRALAGPPARASPPRLALDPGALAGFPQGQVNLSDPAALERLLDGEEPLLLLLPPTAATTGVPATPQGPKSPLWAAGLARRVAAELQAVAAELRALPGLPPAAPPLLARLLALCPGNPDSPGGPLRALLLLKALQGLRAEWRGRERSGSARAQRSAGAAAADGPCALRELSVDLRAERSVLIPETYQANNCQGACGWPQSDRNPRYGNHVVLLLKMQARGATLARPPCCVPTAYTGKLLISLSEERISAHHVPNMVATECGCR
Position of mature hormone in Pre-Hormone protein	551 Residues from position (25-575)
Receptor	N/A
Gene ID	280718
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 10

HMRbase accession number	10592
Swiss-prot Accession number	P09611 (Sequence in FASTA format)
Description	Chorionic somatomammotropin hormone 1 precursor (Placental lactogen I)(BPLP-I).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	236 Amino acids
Molecular weight	26909
References	1  PubMed abstract 2341410 2  PubMed abstract 3242594 3  PubMed abstract 2003877
Domain Name	Hormone_1
Hormone Name	Chorionic somatomammotropin hormone 1
Mature Hormone Sequence	VEDYAPYCKNQPGNCRIPLQSLFERATLVASNNYRLAREMFNEFNKQFGEGKNFTSKVINSCHTEFMTTPNNKEAAANTEDEALLRLVISLLHSWDEPLHQAVTELLHRNGASPDILARAKEIEDKTKVLLEGVEMIQKRVHPGEKKNEPYPVWSEKSSLTADDEDVRQTAFYRMFHCLHRDSSKISTYINLLKCRFTPC
Position of mature hormone in Pre-Hormone protein	200 Residues from position (37-236)
Receptor	N/A
Gene ID	281097
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 11

HMRbase accession number	10593
Swiss-prot Accession number	P19159 (Sequence in FASTA format)
Description	Chorionic somatomammotropin hormone 2 precursor (Placental lactogenII) (BPLP-II).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	238 Amino acids
Molecular weight	27714
References	1  PubMed abstract 2341410
Domain Name	Hormone_1
Hormone Name	Chorionic somatomammotropin hormone 2
Mature Hormone Sequence	ISCPSCGPDMFVSLQKSLIDVFINAASLSHDFHNLSTIMFNEFDEKYAQGKLYYINATKSCHTNSFHTPEERDKAQQMNNEDLSKWTLVLLYSWNNPLYYLLLELRNMKNLSEAVISSAMEIENMSEKLQAFIESQFRKIIVPVLKMIHEVSDTWSRFSSMTFSDEDRSISEYYNLFYCLRRDSRKVDMYIKILTCRTRKTC
Position of mature hormone in Pre-Hormone protein	202 Residues from position (37-238)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 12

HMRbase accession number	10669
Swiss-prot Accession number	P01302 (Sequence in FASTA format)
Description	Pancreatic prohormone precursor (Pancreatic polypeptide) (PP)[Contains: Pancreatic hormone; C-terminal peptide 1; C-terminalpeptide 2].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the NPY family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Pancreatic hormone is synthesized in pancreatic islets of Langerhans and acts as a regulator of pancreatic and gastrointestinal functions
Protein Length	131 Amino acids
Molecular weight	14376
References	1  PubMed abstract 7831336 2   Chance R.E., Moon N.E., Johnson M.G.; (In) Jaffe B.M., Behrman H.R. (eds.);Methods of hormone radioimmunoassay (2nd ed.), pp.657-672, AcademicPress, New York and London (1979). 3  PubMed abstract 1734969
Domain Name	Hormone_3
Hormone Name	Pancreatic hormone
Mature Hormone Sequence	APLEPEYPGDNATPEQMAQYAAELRRYINMLTRPRY
Position of mature hormone in Pre-Hormone protein	36 Residues from position (30-65)
Receptor	N/A
Gene ID	N/A
PDB ID	1BBA   1LJV   1V1D
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 13

HMRbase accession number	10800
Swiss-prot Accession number	P01317 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11393
References	1  PubMed abstract 2456452 2  PubMed abstract 4928892 3  PubMed abstract 14886311 4  PubMed abstract 5545080 5  PubMed abstract 5105368 6  PubMed abstract 13032079 7  PubMed abstract 13249947 8   Smith G.D., Duax W.L., Dodson E.J., Dodson G.G., de Graaf R.A.G.,Reynolds C.D.; "The structure of des-Phe b1 bovine insulin."; Acta Crystallogr. B 38:3028-3032(1982). 9  PubMed abstract 9141131
Domain Name	Insulin
Hormone Name	Insulin B chain
Mature Hormone Sequence	FVNQHLCGSHLVEALYLVCGERGFFYTPKA
Position of mature hormone in Pre-Hormone protein	30 Residues from position (25-54)
Receptor	N/A
Gene ID	280829
PDB ID	1APH   1BPH   1CPH   1DPH   1HO0   1PID   2A3G   2BN1   2BN3   2INS
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 14

HMRbase accession number	10801
Swiss-prot Accession number	P01317 (Sequence in FASTA format)
Description	Insulin precursor [Contains: Insulin B chain; Insulin A chain].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Mevtazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the insulin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Insulin decreases blood glucose concentration. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver
Protein Length	105 Amino acids
Molecular weight	11393
References	1  PubMed abstract 2456452 2  PubMed abstract 4928892 3  PubMed abstract 14886311 4  PubMed abstract 5545080 5  PubMed abstract 5105368 6  PubMed abstract 13032079 7  PubMed abstract 13249947 8   Smith G.D., Duax W.L., Dodson E.J., Dodson G.G., de Graaf R.A.G.,Reynolds C.D.; "The structure of des-Phe b1 bovine insulin."; Acta Crystallogr. B 38:3028-3032(1982). 9  PubMed abstract 9141131
Domain Name	Insulin
Hormone Name	Insulin A chain
Mature Hormone Sequence	GIVEQCCASVCSLYQLENYCN
Position of mature hormone in Pre-Hormone protein	21 Residues from position (85-105)
Receptor	N/A
Gene ID	280829
PDB ID	1APH   1BPH   1CPH   1DPH   1HO0   1PID   2A3G   2BN1   2BN3   2INS
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 15

HMRbase accession number	10915
Swiss-prot Accession number	P01175 (Sequence in FASTA format)
Description	Oxytocin-neurophysin 1 precursor (OT-NPI) [Contains: Oxytocin(Ocytocin); Neurophysin 1].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the vasopressin/oxytocin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Oxytocin causes contraction of the smooth muscle of the uterus and of the mammary gland
Protein Length	125 Amino acids
Molecular weight	12665
References	1  PubMed abstract 3768139 2  PubMed abstract 6709064 3  PubMed abstract 6209133 4  PubMed abstract 13129273 5   Tuppy H., Michl H.; "About the chemical structure of oxytocin."; Monatsh. Chem. 84:1011-1020(1953). 6  PubMed abstract 670174 7  PubMed abstract 428540 8  PubMed abstract 2911588 9  PubMed abstract 3008332
Domain Name	Hormone_5
Hormone Name	Oxytocin
Mature Hormone Sequence	CYIQNCPLG
Position of mature hormone in Pre-Hormone protein	9 Residues from position (20-28)
Receptor	P56449    Detail in HMRbase
Gene ID	280888
PDB ID	1L5C   1L5D   1XY1   1XY2   2HNU   2HNV   2HNW
Drugpedia	wiki
Comments

Search Result - 16

HMRbase accession number	11033
Swiss-prot Accession number	P01260 (Sequence in FASTA format)
Description	Calcitonin.
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the calcitonin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Causes a rapid but short-lived drop in the level of calcium and phosphate in blood by promoting the incorporation of those ions in the bones
Protein Length	32 Amino acids
Molecular weight	3596
References	1  PubMed abstract 5259773
Domain Name	Calc_CGRP_IAPP
Hormone Name	Calcitonin
Mature Hormone Sequence	CSNLSTCVLSAYWKDLNNYHRFSGMGFGPETP
Position of mature hormone in Pre-Hormone protein	32 Residues from position (1-32)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 17

HMRbase accession number	11037
Swiss-prot Accession number	P01252 (Sequence in FASTA format)
Description	Prothymosin alpha [Contains: Thymosin alpha-1].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Nucleus
Developmental Stage	N/A
Similarity	Belongs to the pro/parathymosin family.
Tissue Specificity	N/A
Post translational modification	Covalently linked to a small RNA of about 20 nucleotides (By similarity).
Function	Prothymosin alpha may mediate immune function by conferring resistance to certain opportunistic infections
Protein Length	109 Amino acids
Molecular weight	11941
References	1  PubMed abstract 2901823 2  PubMed abstract 762108 3  PubMed abstract 1426245 4  PubMed abstract 8485135
Domain Name	Prothymosin
Hormone Name	Prothymosin alpha
Mature Hormone Sequence	SDAAVDTSSEITTKDLKEKKEVVEEAENGREAPANGNANEENGEQEADNEVDEEEEEGGEEEEEEEEGDGEEEDGDEDEEAEAATGKRAAEDDEDDDVDTKKQKTDEDD
Position of mature hormone in Pre-Hormone protein	109 Residues from position (2-110)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 18

HMRbase accession number	11038
Swiss-prot Accession number	P01252 (Sequence in FASTA format)
Description	Prothymosin alpha [Contains: Thymosin alpha-1].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Nucleus
Developmental Stage	N/A
Similarity	Belongs to the pro/parathymosin family.
Tissue Specificity	N/A
Post translational modification	Covalently linked to a small RNA of about 20 nucleotides (By similarity).
Function	It is a potent immunopotentiating agent
Protein Length	109 Amino acids
Molecular weight	11941
References	1  PubMed abstract 2901823 2  PubMed abstract 762108 3  PubMed abstract 1426245 4  PubMed abstract 8485135
Domain Name	Prothymosin
Hormone Name	Thymosin alpha-1
Mature Hormone Sequence	SDAAVDTSSEITTKDLKEKKEVVEEAEN
Position of mature hormone in Pre-Hormone protein	28 Residues from position (2-29)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 19

HMRbase accession number	11045
Swiss-prot Accession number	P21752 (Sequence in FASTA format)
Description	Thymosin beta-10 (Thymosin beta-9) [Contains: Thymosin beta-8].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Distributed in numerous types of tissues, including thymus, spleen, lung, liver and muscle
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	42 Amino acids
Molecular weight	4805
References	1   Gutierrez-Pabello J.A., Adams L.G.; "Bovine thymosin beta-10 full length cDNA sequence."; Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6952223 3  PubMed abstract 3818171 4   Gallert B., Zarbock J., Voelter W., Holak T.A.; "A nuclear magnetic resonance and simulated annealing study ofthymosin beta-9 in solution."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.517-518, Escom Science Publishers, Leiden (1993). 5  PubMed abstract 9108730
Domain Name	Thymosin
Hormone Name	Thymosin beta-10
Mature Hormone Sequence	ADKPDLGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQAK
Position of mature hormone in Pre-Hormone protein	41 Residues from position (2-42)
Receptor	N/A
Gene ID	282385
PDB ID	1HJ0
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 20

HMRbase accession number	11046
Swiss-prot Accession number	P21752 (Sequence in FASTA format)
Description	Thymosin beta-10 (Thymosin beta-9) [Contains: Thymosin beta-8].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	Distributed in numerous types of tissues, including thymus, spleen, lung, liver and muscle
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	42 Amino acids
Molecular weight	4805
References	1   Gutierrez-Pabello J.A., Adams L.G.; "Bovine thymosin beta-10 full length cDNA sequence."; Submitted (AUG-2000) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6952223 3  PubMed abstract 3818171 4   Gallert B., Zarbock J., Voelter W., Holak T.A.; "A nuclear magnetic resonance and simulated annealing study ofthymosin beta-9 in solution."; (In) Schneider C.H., Eberles A.N. (eds.);Peptides 1992, pp.517-518, Escom Science Publishers, Leiden (1993). 5  PubMed abstract 9108730
Domain Name	Thymosin
Hormone Name	Thymosin beta-8
Mature Hormone Sequence	ADKPDLGEINSFDKAKLKKTETQEKNTLPTKETIEQEKQ
Position of mature hormone in Pre-Hormone protein	39 Residues from position (2-40)
Receptor	N/A
Gene ID	282385
PDB ID	1HJ0
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 21

HMRbase accession number	11055
Swiss-prot Accession number	P62326 (Sequence in FASTA format)
Description	Thymosin beta-4 (T beta 4) [Contains: Hematopoietic system regulatorypeptide (Seraspenide)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Cytoplasm
Developmental Stage	N/A
Similarity	Belongs to the thymosin beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in the organization of the cytoskeleton. Binds to and sequesters actin monomers (G actin) and therefore inhibits actin polymerization
Protein Length	44 Amino acids
Molecular weight	5053
References	1   Yu J., Meng Y., Wang Z., Hansen C., Li C., Moore S.S.; "Analysis of sequences obtained from constructed full-length bovinecDNA libraries."; Submitted (JAN-2005) to the EMBL/GenBank/DDBJ databases. 2   Submitted (FEB-2007) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 6940133 4  PubMed abstract 2915977 5  PubMed abstract 2253778 6  PubMed abstract 1551869 7  PubMed abstract 2261438 8  PubMed abstract 8269922
Domain Name	Thymosin
Hormone Name	Thymosin beta-4
Mature Hormone Sequence	SDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
Position of mature hormone in Pre-Hormone protein	43 Residues from position (2-44)
Receptor	N/A
Gene ID	781334
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 22

HMRbase accession number	11079
Swiss-prot Accession number	P01272 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Glicentin may modulate gastric acid secretion and gastro-pyloro-duodenal activity
Protein Length	180 Amino acids
Molecular weight	20944
References	1  PubMed abstract 6577439 2   Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 5102927 4  PubMed abstract 12554744 5  PubMed abstract 12626323 6  PubMed abstract 10322410 7  PubMed abstract 10605628 8  PubMed abstract 6631957
Domain Name	Hormone_2
Hormone Name	Glicentin
Mature Hormone Sequence	RSLQNTEEKSSSFPAPQTDPLGDPDQINEDKRHSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Position of mature hormone in Pre-Hormone protein	69 Residues from position (21-89)
Receptor	N/A
Gene ID	280802
PDB ID	1KX6
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 23

HMRbase accession number	11080
Swiss-prot Accession number	P01272 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Oxyntomodulin significantly reduces food intake
Protein Length	180 Amino acids
Molecular weight	20944
References	1  PubMed abstract 6577439 2   Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 5102927 4  PubMed abstract 12554744 5  PubMed abstract 12626323 6  PubMed abstract 10322410 7  PubMed abstract 10605628 8  PubMed abstract 6631957
Domain Name	Hormone_2
Hormone Name	Oxyntomodulin
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNKNNIA
Position of mature hormone in Pre-Hormone protein	37 Residues from position (53-89)
Receptor	N/A
Gene ID	280802
PDB ID	1KX6
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 24

HMRbase accession number	11081
Swiss-prot Accession number	P01272 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	Glucagon plays a key role in glucose metabolism and homeostasis. Regulates blood glucose by increasing gluconeogenesis and decreasing glycolysis. A counterregulatory hormone of insulin, raises plasma glucose levels in response to insulin-induced hypoglycemia
Protein Length	180 Amino acids
Molecular weight	20944
References	1  PubMed abstract 6577439 2   Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 5102927 4  PubMed abstract 12554744 5  PubMed abstract 12626323 6  PubMed abstract 10322410 7  PubMed abstract 10605628 8  PubMed abstract 6631957
Domain Name	Hormone_2
Hormone Name	Glucagon
Mature Hormone Sequence	HSQGTFTSDYSKYLDSRRAQDFVQWLMNT
Position of mature hormone in Pre-Hormone protein	29 Residues from position (53-81)
Receptor	N/A
Gene ID	280802
PDB ID	1KX6
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 25

HMRbase accession number	11082
Swiss-prot Accession number	P01272 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-1 is a potent stimulator of glucose-dependent insulin release. Play important roles on gastric motility and the suppression of plasma glucagon levels. May be involved in the suppression of satiety and stimulation of glucose disposal in peripheral tissues, independent of the actions of insulin. Have growth-promoting activities on intestinal epithelium. May also regulate the hypothalamic pituitary axis (HPA) via effects on LH, TSH, CRH, oxytocin, and vasopressin secretion. Increases islet mass through stimulation of islet neogenesis and pancreatic beta cell proliferaton
Protein Length	180 Amino acids
Molecular weight	20944
References	1  PubMed abstract 6577439 2   Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 5102927 4  PubMed abstract 12554744 5  PubMed abstract 12626323 6  PubMed abstract 10322410 7  PubMed abstract 10605628 8  PubMed abstract 6631957
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 1
Mature Hormone Sequence	HDEFERHAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG
Position of mature hormone in Pre-Hormone protein	37 Residues from position (92-128)
Receptor	N/A
Gene ID	280802
PDB ID	1KX6
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 26

HMRbase accession number	11083
Swiss-prot Accession number	P01272 (Sequence in FASTA format)
Description	Glucagon precursor [Contains: Glicentin; Glicentin-related polypeptide(GRPP); Oxyntomodulin (OXY) (OXM); Glucagon; Glucagon-like peptide 1(GLP-1); Glucagon-like peptide 1(7-37) (GLP-1(7-37)); Glucagon-likepeptide 1(7-36) (GLP-1(7-36)); Glucagon-like peptide 2 (GLP-2)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	Glucagon is secreted in the A cells of the islets of Langerhans. GLP-1, GLP-2, oxyntomodulin and glicentin are secreted from enteroendocrine cells throughout the gastrointestinal tract
Post translational modification	Proglucagon is posttranslationally processed in a tissue- specific manner in pancreatic A cells and intestinal L cells. In pancreatic A cells, the major bioactive hormone is glucagon cleaved by PCSK2/PC2. In the intestinal L cells PCSK1/PC1 liberates GLP-1, GLP-2, glicentin and oxyntomodulin. GLP-1 is further N-terminally truncated by posttranslational processing in the intestinal L cells resulting in GLP-1(7-37) GLP-1-(7-36)amide. The C-terminal amidation is neither important for the metabolism of GLP-1 nor for its effects on the endocrine pancreas (By similarity).
Function	GLP-2 stimulates intestinal growth and up-regulates villus height in the small intestine, concomitant with increased crypt cell proliferation and decreased enterocyte apoptosis. The gastrointestinal tract, from the stomach to the colon is the principal target for GLP-2 action. Plays a key role in nutrient homeostasis, enhancing nutrient assimilation through enhanced gastrointestinal function, as well as increasing nutrient disposal. Stimulates intestinal glucose transport and decreases mucosal permeability
Protein Length	180 Amino acids
Molecular weight	20944
References	1  PubMed abstract 6577439 2   Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 5102927 4  PubMed abstract 12554744 5  PubMed abstract 12626323 6  PubMed abstract 10322410 7  PubMed abstract 10605628 8  PubMed abstract 6631957
Domain Name	Hormone_2
Hormone Name	Glucagon-like peptide 2
Mature Hormone Sequence	HADGSFSDEMNTVLDSLATRDFINWLLQTKITD
Position of mature hormone in Pre-Hormone protein	33 Residues from position (146-178)
Receptor	N/A
Gene ID	280802
PDB ID	1KX6
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 27

HMRbase accession number	11158
Swiss-prot Accession number	Q863C3 (Sequence in FASTA format)
Description	Gastrin-releasing peptide precursor (GRP) [Contains: Neuromedin-C(GRP-10) (GRP-(18-27))] (Fragment).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the bombesin/neuromedin-B/ranatensin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	GRP stimulates gastrin release as well as other gastrointestinal hormones
Protein Length	126 Amino acids
Molecular weight	13840
References	1   Budipitojo T., Sasaki T., Cruzana M.B.C., Kitamura N., Yamada J.; "Molecular cloning of cDNA encoding an endometrial gastrin-releasingpeptide (GRP) of cow."; Submitted (MAR-2003) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2755876
Domain Name	Bombesin
Hormone Name	Gastrin-releasing peptide
Mature Hormone Sequence	APVTAGRGGALAKMYTRGNHWAVGHLM
Position of mature hormone in Pre-Hormone protein	27 Residues from position (24-50)
Receptor	N/A
Gene ID	615323
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 28

HMRbase accession number	11164
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-18
Mature Hormone Sequence	LDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	18 Residues from position (86-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 29

HMRbase accession number	11258
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Beta-endorphin is an endogenous opiate
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Beta-endorphin
Mature Hormone Sequence	YGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	31 Residues from position (235-265)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 30

HMRbase accession number	11259
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin gamma (Gamma-MSH)
Mature Hormone Sequence	YVMGHFRWDRF
Position of mature hormone in Pre-Hormone protein	11 Residues from position (77-87)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 31

HMRbase accession number	11260
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	ACTH stimulates the adrenal glands to release cortisol
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Corticotropin
Mature Hormone Sequence	SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAQAFPLEF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (132-170)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 32

HMRbase accession number	11261
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin alpha (Alpha-MSH)
Mature Hormone Sequence	SYSMEHFRWGKPV
Position of mature hormone in Pre-Hormone protein	13 Residues from position (132-144)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 33

HMRbase accession number	11262
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin beta (Beta-LPH)
Mature Hormone Sequence	ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAEAAEKKDSGPYKMEHFRWGSPPKDKRYGGFMTSEKSQTPLVTLFKNAIIKNAHKKGQ
Position of mature hormone in Pre-Hormone protein	93 Residues from position (173-265)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 34

HMRbase accession number	11263
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Stimulates melanocytes to produce melanin. It performs lipid-mobilizing functions such as lipolysis and steroidogenesis.
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Lipotropin gamma (Gamma-LPH)
Mature Hormone Sequence	ELTGERLEQARGPEAQAESAAARAELEYGLVAEAEAEAAEKKDSGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	60 Residues from position (173-232)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 35

HMRbase accession number	11264
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	MSH (melanocyte-stimulating hormone) increases the pigmentation of skin by increasing melanin production in melanocytes
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Melanotropin beta (Beta-MSH)
Mature Hormone Sequence	DSGPYKMEHFRWGSPPKD
Position of mature hormone in Pre-Hormone protein	18 Residues from position (215-232)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 36

HMRbase accession number	11265
Swiss-prot Accession number	P01190 (Sequence in FASTA format)
Description	Corticotropin-lipotropin precursor (Pro-opiomelanocortin) (POMC)[Contains: NPP; Melanotropin gamma (Gamma-MSH); Corticotropin(Adrenocorticotropic hormone) (ACTH); Melanotropin alpha (Alpha-MSH);Corticotropin-like intermediary peptide (CLIP); Lipotropin beta (Beta-LPH); Lipotropin gamma (Gamma-LPH); Melanotropin beta (Beta-MSH);Beta-endorphin; Met-enkephalin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the POMC family.
Tissue Specificity	ACTH and MSH are produced by the pituitary gland
Post translational modification	Specific enzymatic cleavages at paired basic residues yield the different active peptides.
Function	Met-enkephalin is an endogenous opiate
Protein Length	265 Amino acids
Molecular weight	29260
References	1  PubMed abstract 221818 2  PubMed abstract 6249166 3  PubMed abstract 6263630 4   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6  PubMed abstract 216007 7  PubMed abstract 7274457 8  PubMed abstract 13642798 9   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 10  PubMed abstract 4344689 11   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 12   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 13  PubMed abstract 13348631 14  PubMed abstract 1065904 15  PubMed abstract 4030947 16  PubMed abstract 2266117 17  PubMed abstract 221818 18  PubMed abstract 6249166 19  PubMed abstract 6263630 20   Submitted (AUG-2006) to the EMBL/GenBank/DDBJ databases. 21   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 22  PubMed abstract 216007 23  PubMed abstract 7274457 24  PubMed abstract 13642798 25   Li C.H., Dixon J.S., Chung D.; "Isolation of melatonin, the pineal gland factor that lightensmelanocytes."; J. Am. Chem. Soc. 80:2587-2588(1958). 26  PubMed abstract 4344689 27   Pankov Y.A.; "Primary structure of the bovine beta-lipotropic hormone."; Vopr. Med. Khim. 19:330-332(1973). 28   Geschwind I.I., Li C.H., Barnafi L.; "The isolation and structure of a melanocyte-stimulating hormone frombovine pituitary glands."; J. Am. Chem. Soc. 79:1003-1004(1957). 29  PubMed abstract 13348631 30  PubMed abstract 1065904 31  PubMed abstract 4030947 32  PubMed abstract 2266117
Domain Name	ACTH_domain  NPP  Op_neuropeptide
Hormone Name	Met-enkephalin
Mature Hormone Sequence	YGGFM
Position of mature hormone in Pre-Hormone protein	5 Residues from position (235-239)
Receptor	P47798    Detail in HMRbase
Gene ID	281416
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 37

HMRbase accession number	11301
Swiss-prot Accession number	P01217 (Sequence in FASTA format)
Description	Glycoprotein hormones alpha chain precursor (Anterior pituitaryglycoprotein hormones common subunit alpha) (Follitropin alpha chain)(Follicle-stimulating hormone alpha chain) (FSH-alpha) (Lutropin alphachain) (Luteinizing hormone alpha chain) (LSH-alpha) (Thyrotropinalpha chain) (Thyroid-stimulating hormone alpha chain) (TSH-alpha).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit alpha family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	120 Amino acids
Molecular weight	13616
References	1  PubMed abstract 6314263 2  PubMed abstract 6688736 3  PubMed abstract 6187740 4  PubMed abstract 5101174 5  PubMed abstract 5101175 6  PubMed abstract 5107231 7  PubMed abstract 4854483 8  PubMed abstract 6314263 9  PubMed abstract 6688736 10  PubMed abstract 6187740 11  PubMed abstract 5101174 12  PubMed abstract 5101175 13  PubMed abstract 5107231 14  PubMed abstract 4854483
Domain Name	Hormone_6
Hormone Name	Glycoprotein hormones alpha chain
Mature Hormone Sequence	FPDGEFTMQGCPECKLKENKYFSKPDAPIYQCMGCCFSRAYPTPARSKKTMLVPKNITSEATCCVAKAFTKATVMGNVRVENHTECHCSTCYYHKS
Position of mature hormone in Pre-Hormone protein	96 Residues from position (25-120)
Receptor	P35376   Detail in HMRbase    Q28005   Detail in HMRbase    Q27987    Detail in HMRbase
Gene ID	280749
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 38

HMRbase accession number	11306
Swiss-prot Accession number	P01223 (Sequence in FASTA format)
Description	Thyrotropin subunit beta precursor (Thyroid-stimulating hormonesubunit beta) (TSH-beta) (TSH-B) (Thyrotropin beta chain).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Indispensable for the control of thyroid structure and metabolism
Protein Length	138 Amino acids
Molecular weight	15624
References	1  PubMed abstract 6325416 2  PubMed abstract 5101174 3  PubMed abstract 5101173 4  PubMed abstract 8670056
Domain Name	Cys_knot
Hormone Name	Thyroid-stimulating hormone subunit beta (TSH-B) (Thyrotropin beta chain)
Mature Hormone Sequence	FCIPTEYMMHVERKECAYCLTINTTVCAGYCMTRDVNGKLFLPKYALSQDVCTYRDFMYKTAEIPGCPRHVTPYFSYPVAISCKCGKCNTDYSDCIHEAIKTNYCTKPQKSY
Position of mature hormone in Pre-Hormone protein	112 Residues from position (21-132)
Receptor	Q27987    Detail in HMRbase
Gene ID	281552
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 39

HMRbase accession number	11317
Swiss-prot Accession number	P01239 (Sequence in FASTA format)
Description	Prolactin precursor (PRL).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Prolactin acts primarily on the mammary gland by promoting lactation
Protein Length	229 Amino acids
Molecular weight	25793
References	1  PubMed abstract 6274859 2   Cao X., Huang S.Z., Ren Z.R., Zeng Y.T.; Submitted (SEP-2001) to the EMBL/GenBank/DDBJ databases. 3  PubMed abstract 6299665 4  PubMed abstract 6897772 5   Rubtsov P.M., Oganesyan R.G., Gorbulev V.G., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones. II. Possible polymorphism ofpreprolactin in cattle. Data of molecular cloning."; Mol. Biol. (Mosk.) 22:117-127(1988). 6  PubMed abstract 4608931 7  PubMed abstract 5507606 8  PubMed abstract 8250856
Domain Name	Hormone_1
Hormone Name	Prolactin
Mature Hormone Sequence	TPVCPNGPGNCQVSLRDLFDRAVMVSHYIHDLSSEMFNEFDKRYAQGKGFITMALNSCHTSSLPTPEDKEQAQQTHHEVLMSLILGLLRSWNDPLYHLVTEVRGMKGAPDAILSRAIEIEEENKRLLEGMEMIFGQVIPGAKETEPYPVWSGLPSLQTKDEDARYSAFYNLLHCLRRDSSKIDTYLKLLNCRIIYNNNC
Position of mature hormone in Pre-Hormone protein	199 Residues from position (31-229)
Receptor	Q28172    Detail in HMRbase
Gene ID	280901
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 40

HMRbase accession number	11321
Swiss-prot Accession number	P01246 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays an important role in growth control. Its major role in stimulating body growth is to stimulate the liver and other tissues to secrete IGF-1. It stimulates both the differentiation and proliferation of myoblasts. It also stimulates amino acid uptake and protein synthesis in muscle and other tissues
Protein Length	217 Amino acids
Molecular weight	24558
References	1  PubMed abstract 6893197 2  PubMed abstract 6296767 3  PubMed abstract 6303731 4  PubMed abstract 6357899 5   Rubtsov P.M., Chernov B.K., Gorbulev V.G., Parsadanyan A.S.,Sverdlova P.S., Chupeeva V.V., Golova Y.B., Batchikova N.V.,Zhvirblis G.S., Skryabin K.G., Baev A.A.; "Genetic engineering of peptide hormones."; Mol. Biol. (Mosk.) 19:226-235(1985). 6   Mauro S.M.Z., Ferro M.I.T., Macari M., Ferro J.A.; "The complete sequence of a cDNA encoding the bovine growth hormone."; Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases. 7   Javadmanesh A., Nassiry M., Eftekhari Shahrudi F., Basami M.; "Cloning the cDNA of bovine growth hormone gene in E. coli."; Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 8  PubMed abstract 4584625 9  PubMed abstract 4580883 10  PubMed abstract 3899556 11  PubMed abstract 4856718 12  PubMed abstract 5579941 13  PubMed abstract 1123321 14  PubMed abstract 2021631
Domain Name	Hormone_1
Hormone Name	Growth hormone (Somatotropin) (GH)
Mature Hormone Sequence	AFPAMSLSGLFANAVLRAQHLHQLAADTFKEFERTYIPEGQRYSIQNTQVAFCFSETIPAPTGKNEAQQKSDLELLRISLLLIQSWLGPLQFLSRVFTNSLVFGTSDRVYEKLKDLEEGILALMRELEDGTPRAGQILKQTYDKFDTNMRSDDALLKNYGLLSCFRKDLHKTETYLRVMKCRRFGEASCAF
Position of mature hormone in Pre-Hormone protein	191 Residues from position (27-217)
Receptor	O46600    Detail in HMRbase
Gene ID	280804
PDB ID	1BST
Drugpedia	wiki
Comments

Search Result - 41

HMRbase accession number	11326
Swiss-prot Accession number	P01268 (Sequence in FASTA format)
Description	Parathyroid hormone precursor (Parathyrin) (PTH).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the parathyroid hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	PTH elevates calcium level by dissolving the salts in bone and preventing their renal excretion
Protein Length	115 Amino acids
Molecular weight	12980
References	1  PubMed abstract 388425 2  PubMed abstract 6170060 3  PubMed abstract 6185374 4  PubMed abstract 6086460 5  PubMed abstract 4522780 6  PubMed abstract 5531031 7  PubMed abstract 5275384 8  PubMed abstract 4322265 9  PubMed abstract 10623601
Domain Name	Parathyroid
Hormone Name	Parathyroid hormone (Parathyrin) (PTH)
Mature Hormone Sequence	AVSEIQFMHNLGKHLSSMERVEWLRKKLQDVHNFVALGASIAYRDGSSQRPRKKEDNVLVESHQKSLGEADKADVDVLIKAKPQ
Position of mature hormone in Pre-Hormone protein	84 Residues from position (32-115)
Receptor	Q1LZF7    Detail in HMRbase
Gene ID	280903
PDB ID	1ZWC
Drugpedia	wiki
Comments

Search Result - 42

HMRbase accession number	11350
Swiss-prot Accession number	P01352 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11573
References	1  PubMed abstract 2608050 2  PubMed abstract 1773057 3  PubMed abstract 5665711
Domain Name	Gastrin
Hormone Name	Big gastrin
Mature Hormone Sequence	QLGLQDPPHMVADLSKKQGPWVEEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	34 Residues from position (59-92)
Receptor	P79266    Detail in HMRbase
Gene ID	280800
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 43

HMRbase accession number	11351
Swiss-prot Accession number	P01352 (Sequence in FASTA format)
Description	Gastrin precursor [Contains: Big gastrin (Gastrin 34) (G34); Gastrin].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Gastrin stimulates the stomach mucosa to produce and secrete hydrochloric acid and the pancreas to secrete its digestive enzymes. It also stimulates smooth muscle contraction and increases blood circulation and water secretion in the stomach and intestine
Protein Length	104 Amino acids
Molecular weight	11573
References	1  PubMed abstract 2608050 2  PubMed abstract 1773057 3  PubMed abstract 5665711
Domain Name	Gastrin
Hormone Name	Gastrin
Mature Hormone Sequence	QGPWVEEEEAAYGWMDF
Position of mature hormone in Pre-Hormone protein	17 Residues from position (76-92)
Receptor	P79266    Detail in HMRbase
Gene ID	280800
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 44

HMRbase accession number	11366
Swiss-prot Accession number	P04651 (Sequence in FASTA format)
Description	Lutropin subunit beta precursor (Luteinizing hormone subunit beta)(LSH-beta) (LSH-B) (LH-B) (Lutropin beta chain).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Promotes spermatogenesis and ovulation by stimulating the testes and ovaries to synthesize steroids
Protein Length	141 Amino acids
Molecular weight	15202
References	1  PubMed abstract 2987241 2  PubMed abstract 3838746 3  PubMed abstract 4770795
Domain Name	Cys_knot
Hormone Name	Luteinizing hormone subunit beta (LSH-B) (LH-B)(Lutropin subunit beta)
Mature Hormone Sequence	SRGPLRPLCQPINATLAAEKEACPVCITFTTSICAGYCPSMKRVLPVILPPMPQRVCTYHELRFASVRLPGCPPGVDPMVSFPVALSCHCGPCRLSSTDCGGPRTQPLACDHPPLPDILFL
Position of mature hormone in Pre-Hormone protein	121 Residues from position (21-141)
Receptor	Q28005    Detail in HMRbase
Gene ID	280839   786429
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 45

HMRbase accession number	11371
Swiss-prot Accession number	P04837 (Sequence in FASTA format)
Description	Follitropin subunit beta precursor (Follicle-stimulating hormone betasubunit) (FSH-beta) (FSH-B) (Follitropin beta chain).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the glycoprotein hormones subunit beta family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Stimulates development of follicle and spermatogenesis in the reproductive organs
Protein Length	129 Amino acids
Molecular weight	14713
References	1  PubMed abstract 3092216 2  PubMed abstract 3096676 3  PubMed abstract 2840246 4  PubMed abstract 3092216 5  PubMed abstract 3096676 6  PubMed abstract 2840246
Domain Name	Cys_knot
Hormone Name	Follicle-stimulating hormone beta subunit
Mature Hormone Sequence	CELTNITITVEKEECGFCISINTTWCAGYCYTRDLVYRDPARPNIQKTCTFKELVYETVKVPGCAHHADSLYTYPVATECHCSKCDSDSTDCTVRGLGPSYCSFREIKE
Position of mature hormone in Pre-Hormone protein	109 Residues from position (21-129)
Receptor	P35376    Detail in HMRbase
Gene ID	281171
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 46

HMRbase accession number	11432
Swiss-prot Accession number	P26917 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-28; Somatostatin-14].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12689
References	1  PubMed abstract 2899837 2  PubMed abstract 10100681 3   Morsci N.S., Schnabel R.D., Taylor J.F.; Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 4   Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Somatostatin
Hormone Name	Somatostatin-28
Mature Hormone Sequence	SANSNPAMAPRERKAGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	28 Residues from position (89-116)
Receptor	P34993    Detail in HMRbase
Gene ID	280932
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 47

HMRbase accession number	11433
Swiss-prot Accession number	P26917 (Sequence in FASTA format)
Description	Somatostatin precursor [Contains: Somatostatin-28; Somatostatin-14].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatostatin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Somatostatin inhibits the release of somatotropin
Protein Length	116 Amino acids
Molecular weight	12689
References	1  PubMed abstract 2899837 2  PubMed abstract 10100681 3   Morsci N.S., Schnabel R.D., Taylor J.F.; Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases. 4   Submitted (AUG-2005) to the EMBL/GenBank/DDBJ databases.
Domain Name	Somatostatin
Hormone Name	Somatostatin-14
Mature Hormone Sequence	AGCKNFFWKTFTSC
Position of mature hormone in Pre-Hormone protein	14 Residues from position (103-116)
Receptor	P34993    Detail in HMRbase
Gene ID	280932
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 48

HMRbase accession number	11445
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin
Mature Hormone Sequence	QPMPHADPTGPRAQQAEEAPRRQLRAVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDFGRRSAEEFEYTS
Position of mature hormone in Pre-Hormone protein	95 Residues from position (21-115)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 49

HMRbase accession number	11446
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-58
Mature Hormone Sequence	AVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	58 Residues from position (46-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 50

HMRbase accession number	11447
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-58 desnonopeptide
Mature Hormone Sequence	AVPRVDDEPRAQLGALLARYIQQARKAPSGRMSVIKNLQSLDPSHRISD
Position of mature hormone in Pre-Hormone protein	49 Residues from position (46-94)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 51

HMRbase accession number	11448
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-39
Mature Hormone Sequence	YIQQARKAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	39 Residues from position (65-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 52

HMRbase accession number	11449
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-33
Mature Hormone Sequence	KAPSGRMSVIKNLQSLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	33 Residues from position (71-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 53

HMRbase accession number	11450
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-25
Mature Hormone Sequence	VIKNLQSLDPSHRISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	25 Residues from position (79-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 54

HMRbase accession number	11451
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-12
Mature Hormone Sequence	ISDRDYMGWMDF
Position of mature hormone in Pre-Hormone protein	12 Residues from position (92-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 55

HMRbase accession number	11452
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-8
Mature Hormone Sequence	DYMGWMDF
Position of mature hormone in Pre-Hormone protein	8 Residues from position (96-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 56

HMRbase accession number	11453
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-7
Mature Hormone Sequence	YMGWMDF
Position of mature hormone in Pre-Hormone protein	7 Residues from position (97-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 57

HMRbase accession number	11454
Swiss-prot Accession number	P41520 (Sequence in FASTA format)
Description	Cholecystokinins precursor (CCK) [Contains: Cholecystokinin 58(CCK58); Cholecystokinin 39 (CCK39); Cholecystokinin 33 (CCK33);Cholecystokinin 12 (CCK12); Cholecystokinin 8 (CCK8)].
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the gastrin/cholecystokinin family.
Tissue Specificity	N/A
Post translational modification	The precursor cleaved by enzymes to produce a number of active cholecystokinins.
Function	This peptide hormone induces gall bladder contraction and the release of pancreatic enzymes in the gut. Its function in the brain is not clear. Binding to CCK-A receptors stimulates amylase release from the pancreas, binding to CCK-B receptors stimulates gastric acid secretion
Protein Length	115 Amino acids
Molecular weight	12835
References	1   Submitted (FEB-2006) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 2217909 3  PubMed abstract 4011954
Domain Name	Gastrin
Hormone Name	Cholecystokinin-5
Mature Hormone Sequence	GWMDF
Position of mature hormone in Pre-Hormone protein	5 Residues from position (99-103)
Receptor	P79266    Detail in HMRbase
Gene ID	617510
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 58

HMRbase accession number	11493
Swiss-prot Accession number	P63292 (Sequence in FASTA format)
Description	Somatoliberin precursor (Growth hormone-releasing factor) (GRF)(Growth hormone-releasing hormone) (GHRH).
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the glucagon family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	GRF is released by the hypothalamus and acts on the adenohypophyse to stimulate the secretion of growth hormone
Protein Length	106 Amino acids
Molecular weight	12058
References	1   Zhou P., Kazmer G.W., Yang X.; Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases. 2  PubMed abstract 6421287
Domain Name	Hormone_2
Hormone Name	Somatoliberin
Mature Hormone Sequence	YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL
Position of mature hormone in Pre-Hormone protein	44 Residues from position (31-74)
Receptor	Q9BDH9   Detail in HMRbase    Q9N1F8   Detail in HMRbase    Q9TUJ0   Detail in HMRbase    Q9TUJ1    Detail in HMRbase
Gene ID	281191
PDB ID	N/A
Drugpedia	wiki
Comments

Search Result - 59

HMRbase accession number	11522
Swiss-prot Accession number	P50595 (Sequence in FASTA format)
Description	Leptin;Alternative Name: Obesity factor; Precursor
Source organism	Bos taurus (Bovine)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Mammalia; Eutheria; Laurasiatheria; Cetartiodactyla; Ruminantia;Pecora; Bovidae; Bovinae; Bos.
Subcellular location	Secreted (Probable)
Developmental Stage	N/A
Similarity	Belongs to the leptin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	May function as part of a signaling pathway that acts to regulate the size of the body fat depot. An increase in the level of LEP may act directly or indirectly on the CNS to inhibit food intake and/or regulate energy expenditure as part of a homeostatic mechanism to maintain constancy of the adipose mass.
Protein Length	167 Amino acids
Molecular weight	18716
References	1  PubMed abstract 10594237 2  PubMed abstract 14629116 3  PubMed abstract 16305752 4  PubMed abstract 8661738
Domain Name	Leptin
Hormone Name	Leptin
Mature Hormone Sequence
Position of mature hormone in Pre-Hormone protein
Receptor	Q32PD8   Detail in HMRbase    Q3SYT0   Detail in HMRbase    Q59HQ0   Detail in HMRbase    Q5KQU4   Detail in HMRbase    Q5KQU5    Detail in HMRbase
Gene ID	280836
PDB ID	2A16
Drugpedia	wiki
Comments